MLL4 monoclonal antibody (M01), clone 1F6 View larger

MLL4 monoclonal antibody (M01), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MLL4 monoclonal antibody (M01), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MLL4 monoclonal antibody (M01), clone 1F6

Brand: Abnova
Reference: H00009757-M01
Product name: MLL4 monoclonal antibody (M01), clone 1F6
Product description: Mouse monoclonal antibody raised against a partial recombinant MLL4.
Clone: 1F6
Isotype: IgG1 Kappa
Gene id: 9757
Gene name: MLL4
Gene alias: HRX2|KIAA0304|MLL2|TRX2|WBP7
Gene description: myeloid/lymphoid or mixed-lineage leukemia 4
Genbank accession: NM_014727
Immunogen: MLL4 (NP_055542, 813 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
Protein accession: NP_055542
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009757-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009757-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MLL4 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MLL4 monoclonal antibody (M01), clone 1F6 now

Add to cart