SNPH monoclonal antibody (M03), clone 3B6 View larger

SNPH monoclonal antibody (M03), clone 3B6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNPH monoclonal antibody (M03), clone 3B6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SNPH monoclonal antibody (M03), clone 3B6

Brand: Abnova
Reference: H00009751-M03
Product name: SNPH monoclonal antibody (M03), clone 3B6
Product description: Mouse monoclonal antibody raised against a partial recombinant SNPH.
Clone: 3B6
Isotype: IgG2a Kappa
Gene id: 9751
Gene name: SNPH
Gene alias: KIAA0374|MGC46096|bA314N13.5
Gene description: syntaphilin
Genbank accession: NM_014723
Immunogen: SNPH (NP_055538.2, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLSRTDALEASSLLSSGVDCGTEETSLHSSFGLGPRFPASNTYEKLLCGMEAGVQASCMQERAIQTDFVQYQPDLDTILEKVTQAQVCGTDPESGDRC
Protein accession: NP_055538.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009751-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009751-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged SNPH is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SNPH monoclonal antibody (M03), clone 3B6 now

Add to cart