Brand: | Abnova |
Reference: | H00009748-M01 |
Product name: | SLK monoclonal antibody (M01), clone 3E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLK. |
Clone: | 3E9 |
Isotype: | IgG1 Kappa |
Gene id: | 9748 |
Gene name: | SLK |
Gene alias: | KIAA0204|LOSK|MGC133067|STK2|bA16H23.1|se20-9 |
Gene description: | STE20-like kinase (yeast) |
Genbank accession: | NM_014720 |
Immunogen: | SLK (NP_055535, 1126 a.a. ~ 1235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS |
Protein accession: | NP_055535 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to SLK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |