SART3 purified MaxPab mouse polyclonal antibody (B01P) View larger

SART3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SART3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about SART3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009733-B01P
Product name: SART3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human SART3 protein.
Gene id: 9733
Gene name: SART3
Gene alias: DSAP1|KIAA0156|MGC138188|P100|RP11-13G14|TIP110|p110|p110(nrb)
Gene description: squamous cell carcinoma antigen recognized by T cells 3
Genbank accession: BC041638.1
Immunogen: SART3 (AAH41638.1, 1 a.a. ~ 129 a.a) full-length human protein.
Immunogen sequence/protein sequence: MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQVGPGVGSGHLPVFQVLGSPCPGPPP
Protein accession: AAH41638.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009733-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SART3 expression in transfected 293T cell line (H00009733-T01) by SART3 MaxPab polyclonal antibody.

Lane 1: SART3 transfected lysate(14.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SART3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart