DOCK4 polyclonal antibody (A01) View larger

DOCK4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DOCK4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DOCK4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009732-A01
Product name: DOCK4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DOCK4.
Gene id: 9732
Gene name: DOCK4
Gene alias: FLJ34238|KIAA0716|MGC134911|MGC134912
Gene description: dedicator of cytokinesis 4
Genbank accession: NM_014705
Immunogen: DOCK4 (NP_055520, 1867 a.a. ~ 1966 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
Protein accession: NP_055520
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009732-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DOCK4 polyclonal antibody (A01) now

Add to cart