Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HERPUD1 monoclonal antibody (M04), clone 2G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about HERPUD1 monoclonal antibody (M04), clone 2G7
| Brand: | Abnova |
| Reference: | H00009709-M04 |
| Product name: | HERPUD1 monoclonal antibody (M04), clone 2G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HERPUD1. |
| Clone: | 2G7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9709 |
| Gene name: | HERPUD1 |
| Gene alias: | HERP|KIAA0025|Mif1|SUP |
| Gene description: | homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 |
| Genbank accession: | NM_014685 |
| Immunogen: | HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ |
| Protein accession: | NP_055500 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HERPUD1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Radioprotective effects of genistein on HL-7702 cells via the inhibition of apoptosis and DNA damage.Song L, Ma L, Cong F, Shen X, Jing P, Ying X, Zhou H, Jiang J, Yan H. Cancer Lett. 2015 Jun 18. [Epub ahead of print] |