Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HERPUD1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HERPUD1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00009709-A01 |
| Product name: | HERPUD1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HERPUD1. |
| Gene id: | 9709 |
| Gene name: | HERPUD1 |
| Gene alias: | HERP|KIAA0025|Mif1|SUP |
| Gene description: | homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 1 |
| Genbank accession: | NM_014685 |
| Immunogen: | HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ |
| Protein accession: | NP_055500 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Apoptosis induction of 2'-hydroxycinnamaldehyde as a proteasome inhibitor is associated with ER stress and mitochondrial perturbation in cancer cells.Hong SH, Kim J, Kim JM, Lee SY, Shin DS, Son KH, Han DC, Sung YK, Kwon BM. Biochem Pharmacol. 2007 Aug 15;74(4):557-65. Epub 2007 May 24. |