Brand: | Abnova |
Reference: | H00009706-M05 |
Product name: | ULK2 monoclonal antibody (M05), clone 2A12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ULK2. |
Clone: | 2A12 |
Isotype: | IgG2a Kappa |
Gene id: | 9706 |
Gene name: | ULK2 |
Gene alias: | KIAA0623|Unc51.2 |
Gene description: | unc-51-like kinase 2 (C. elegans) |
Genbank accession: | BC034988 |
Immunogen: | ULK2 (AAH34988, 743 a.a. ~ 843 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECVLDL |
Protein accession: | AAH34988 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ULK2 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |