ULK2 polyclonal antibody (A01) View larger

ULK2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ULK2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ULK2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00009706-A01
Product name: ULK2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ULK2.
Gene id: 9706
Gene name: ULK2
Gene alias: KIAA0623|Unc51.2
Gene description: unc-51-like kinase 2 (C. elegans)
Genbank accession: BC034988
Immunogen: ULK2 (AAH34988, 743 a.a. ~ 843 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: FLRTRTTSVGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTDTLRHLNVMLMFTECVLDL
Protein accession: AAH34988
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009706-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ULK2 polyclonal antibody (A01) now

Add to cart