CEP57 (Human) Recombinant Protein (Q02) View larger

CEP57 (Human) Recombinant Protein (Q02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEP57 (Human) Recombinant Protein (Q02)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about CEP57 (Human) Recombinant Protein (Q02)

Brand: Abnova
Reference: H00009702-Q02
Product name: CEP57 (Human) Recombinant Protein (Q02)
Product description: Human CEP57 partial ORF (NP_055494.2, 19 a.a. - 128 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 9702
Gene name: CEP57
Gene alias: KIAA0092|PIG8|TSP57
Gene description: centrosomal protein 57kDa
Genbank accession: NM_014679.3
Immunogen sequence/protein sequence: AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE
Protein accession: NP_055494.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00009702-Q02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CEP57 (Human) Recombinant Protein (Q02) now

Add to cart