Brand: | Abnova |
Reference: | H00009702-M02 |
Product name: | CEP57 monoclonal antibody (M02), clone 1E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CEP57. |
Clone: | 1E9 |
Isotype: | IgG1 Kappa |
Gene id: | 9702 |
Gene name: | CEP57 |
Gene alias: | KIAA0092|PIG8|TSP57 |
Gene description: | centrosomal protein 57kDa |
Genbank accession: | NM_014679 |
Immunogen: | CEP57 (NP_055494, 19 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE |
Protein accession: | NP_055494 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to CEP57 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |