TRAM2 monoclonal antibody (M03), clone 3G6 View larger

TRAM2 monoclonal antibody (M03), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRAM2 monoclonal antibody (M03), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about TRAM2 monoclonal antibody (M03), clone 3G6

Brand: Abnova
Reference: H00009697-M03
Product name: TRAM2 monoclonal antibody (M03), clone 3G6
Product description: Mouse monoclonal antibody raised against a partial recombinant TRAM2.
Clone: 3G6
Isotype: IgG1 Kappa
Gene id: 9697
Gene name: TRAM2
Gene alias: KIAA0057
Gene description: translocation associated membrane protein 2
Genbank accession: NM_012288
Immunogen: TRAM2 (NP_036420, 310 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKS
Protein accession: NP_036420
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009697-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009697-M03-3-7-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to TRAM2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TRAM2 monoclonal antibody (M03), clone 3G6 now

Add to cart