Brand: | Abnova |
Reference: | H00009695-M02 |
Product name: | EDEM1 monoclonal antibody (M02), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EDEM1. |
Clone: | 2D3 |
Isotype: | IgG2a Kappa |
Gene id: | 9695 |
Gene name: | EDEM1 |
Gene alias: | EDEM|FLJ51559|FLJ51560|KIAA0212 |
Gene description: | ER degradation enhancer, mannosidase alpha-like 1 |
Genbank accession: | NM_014674 |
Immunogen: | EDEM1 (NP_055489.1, 559 a.a. ~ 656 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL |
Protein accession: | NP_055489.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged EDEM1 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |