Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAPGEF2 monoclonal antibody (M01), clone 1E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about RAPGEF2 monoclonal antibody (M01), clone 1E8
| Brand: | Abnova |
| Reference: | H00009693-M01 |
| Product name: | RAPGEF2 monoclonal antibody (M01), clone 1E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAPGEF2. |
| Clone: | 1E8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9693 |
| Gene name: | RAPGEF2 |
| Gene alias: | CNrasGEF|NRAPGEP|PDZ-GEF1|PDZGEF1|RA-GEF|Rap-GEP |
| Gene description: | Rap guanine nucleotide exchange factor (GEF) 2 |
| Genbank accession: | XM_376350 |
| Immunogen: | RAPGEF2 (XP_376350, 1398 a.a. ~ 1487 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHKPNESDPRLAPYQSQGFSTEEDEDEQVSAV |
| Protein accession: | XP_376350 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged RAPGEF2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | PKC{theta} selectively controls the adhesion-stimulating molecule Rap1.Letschka T, Kollmann V, Pfeifhofer-Obermair C, Lutz-Nicoladoni C, Obermair GJ, Fresser F, Leitges M, Hermann-Kleiter N, Kaminski S, Baier G. Blood. 2008 Dec 1;112(12):4617-27. Epub 2008 Sep 16. |