H00009641-M07_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00009641-M07 |
Product name: | IKBKE monoclonal antibody (M07), clone 3D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IKBKE. |
Clone: | 3D11 |
Isotype: | IgG2b Kappa |
Gene id: | 9641 |
Gene name: | IKBKE |
Gene alias: | IKK-i|IKKE|IKKI|KIAA0151|MGC125294|MGC125295|MGC125297 |
Gene description: | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon |
Genbank accession: | NM_014002 |
Immunogen: | IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE |
Protein accession: | NP_054721 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged IKBKE is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |