Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IKBKE monoclonal antibody (M04), clone 1F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA |
More info about IKBKE monoclonal antibody (M04), clone 1F7
| Brand: | Abnova |
| Reference: | H00009641-M04 |
| Product name: | IKBKE monoclonal antibody (M04), clone 1F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IKBKE. |
| Clone: | 1F7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 9641 |
| Gene name: | IKBKE |
| Gene alias: | IKK-i|IKKE|IKKI|KIAA0151|MGC125294|MGC125295|MGC125297 |
| Gene description: | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon |
| Genbank accession: | NM_014002 |
| Immunogen: | IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE |
| Protein accession: | NP_054721 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to IKBKE on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |