Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of G1P2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about G1P2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00009636-B01P |
| Product name: | G1P2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human G1P2 protein. |
| Gene id: | 9636 |
| Gene name: | ISG15 |
| Gene alias: | G1P2|IFI15|UCRP |
| Gene description: | ISG15 ubiquitin-like modifier |
| Genbank accession: | NM_005101.1 |
| Immunogen: | G1P2 (ENSP00000368699, 1 a.a. ~ 165 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS |
| Protein accession: | ENSP00000368699 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ISG15 expression in transfected 293T cell line (H00009636-T01) by ISG15 MaxPab polyclonal antibody. Lane 1: G1P2 transfected lysate(18.15 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | ISG15 is a critical microenvironmental factor for pancreatic cancer stem cells.Sainz B Jr, Martin B, Tatari M, Heeschen C, Guerra S. Cancer Res. 2014 Dec 15;74(24):7309-20. |