Brand: | Abnova |
Reference: | H00009633-M01 |
Product name: | MTL5 monoclonal antibody (M01), clone 4H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MTL5. |
Clone: | 4H4 |
Isotype: | IgG2a Kappa |
Gene id: | 9633 |
Gene name: | MTL5 |
Gene alias: | CXCDC2|MTLT|TESMIN |
Gene description: | metallothionein-like 5, testis-specific (tesmin) |
Genbank accession: | NM_004923 |
Immunogen: | MTL5 (NP_004914, 399 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME |
Protein accession: | NP_004914 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MTL5 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |