GNA14 monoclonal antibody (M06A), clone 2H8 View larger

GNA14 monoclonal antibody (M06A), clone 2H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNA14 monoclonal antibody (M06A), clone 2H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about GNA14 monoclonal antibody (M06A), clone 2H8

Brand: Abnova
Reference: H00009630-M06A
Product name: GNA14 monoclonal antibody (M06A), clone 2H8
Product description: Mouse monoclonal antibody raised against a partial recombinant GNA14.
Clone: 2H8
Isotype: IgG1 Kappa
Gene id: 9630
Gene name: GNA14
Gene alias: -
Gene description: guanine nucleotide binding protein (G protein), alpha 14
Genbank accession: BC027886
Immunogen: GNA14 (AAH27886.1, 150 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKAL
Protein accession: AAH27886.1
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009630-M06A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009630-M06A-13-15-1.jpg
Application image note: Western Blot analysis of GNA14 expression in transfected 293T cell line by GNA14 monoclonal antibody (M06A), clone 2H8.

Lane 1: GNA14 transfected lysate(41.6 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GNA14 monoclonal antibody (M06A), clone 2H8 now

Add to cart