GNA14 purified MaxPab mouse polyclonal antibody (B01P) View larger

GNA14 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GNA14 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GNA14 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009630-B01P
Product name: GNA14 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GNA14 protein.
Gene id: 9630
Gene name: GNA14
Gene alias: -
Gene description: guanine nucleotide binding protein (G protein), alpha 14
Genbank accession: NM_004297.2
Immunogen: GNA14 (NP_004288.1, 1 a.a. ~ 355 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
Protein accession: NP_004288.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009630-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GNA14 expression in transfected 293T cell line (H00009630-T02) by GNA14 MaxPab polyclonal antibody.

Lane 1: GNA14 transfected lysate(41.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GNA14 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart