Brand: | Abnova |
Reference: | H00009627-M01 |
Product name: | SNCAIP monoclonal antibody (M01), clone 2A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SNCAIP. |
Clone: | 2A8 |
Isotype: | IgG1 Kappa |
Gene id: | 9627 |
Gene name: | SNCAIP |
Gene alias: | MGC39814|SYPH1 |
Gene description: | synuclein, alpha interacting protein |
Genbank accession: | NM_005460 |
Immunogen: | SNCAIP (NP_005451, 206 a.a. ~ 309 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PFCVLSPVKSPHLRKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGP |
Protein accession: | NP_005451 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SNCAIP is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |