GUCA1C purified MaxPab mouse polyclonal antibody (B01P) View larger

GUCA1C purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GUCA1C purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GUCA1C purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009626-B01P
Product name: GUCA1C purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GUCA1C protein.
Gene id: 9626
Gene name: GUCA1C
Gene alias: GCAP3|MGC120158|MGC120159
Gene description: guanylate cyclase activator 1C
Genbank accession: NM_005459.2
Immunogen: GUCA1C (NP_005450.2, 1 a.a. ~ 209 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK
Protein accession: NP_005450.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009626-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GUCA1C expression in transfected 293T cell line (H00009626-T01) by GUCA1C MaxPab polyclonal antibody.

Lane 1: GUCA1C transfected lysate(22.99 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GUCA1C purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart