AATK monoclonal antibody (M04), clone 2C8 View larger

AATK monoclonal antibody (M04), clone 2C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AATK monoclonal antibody (M04), clone 2C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about AATK monoclonal antibody (M04), clone 2C8

Brand: Abnova
Reference: H00009625-M04
Product name: AATK monoclonal antibody (M04), clone 2C8
Product description: Mouse monoclonal antibody raised against a partial recombinant AATK.
Clone: 2C8
Isotype: IgG1 Kappa
Gene id: 9625
Gene name: AATK
Gene alias: AATYK|AATYK1|KIAA0641|LMR1|LMTK1|p35BP
Gene description: apoptosis-associated tyrosine kinase
Genbank accession: BC047378
Immunogen: AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG
Protein accession: AAH47378
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009625-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009625-M04-1-8-1.jpg
Application image note: AATK monoclonal antibody (M04), clone 2C8 Western Blot analysis of AATK expression in NIH/3T3 ( Cat # L018V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AATK monoclonal antibody (M04), clone 2C8 now

Add to cart