Brand: | Abnova |
Reference: | H00009625-M03 |
Product name: | AATK monoclonal antibody (M03), clone 5B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AATK. |
Clone: | 5B8 |
Isotype: | IgG1 Kappa |
Gene id: | 9625 |
Gene name: | AATK |
Gene alias: | AATYK|AATYK1|KIAA0641|LMR1|LMTK1|p35BP |
Gene description: | apoptosis-associated tyrosine kinase |
Genbank accession: | BC047378 |
Immunogen: | AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG |
Protein accession: | AAH47378 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to AATK on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |