AATK monoclonal antibody (M02), clone 2D10 View larger

AATK monoclonal antibody (M02), clone 2D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AATK monoclonal antibody (M02), clone 2D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about AATK monoclonal antibody (M02), clone 2D10

Brand: Abnova
Reference: H00009625-M02
Product name: AATK monoclonal antibody (M02), clone 2D10
Product description: Mouse monoclonal antibody raised against a partial recombinant AATK.
Clone: 2D10
Isotype: IgG1 Kappa
Gene id: 9625
Gene name: AATK
Gene alias: AATYK|AATYK1|KIAA0641|LMR1|LMTK1|p35BP
Gene description: apoptosis-associated tyrosine kinase
Genbank accession: BC047378
Immunogen: AATK (AAH47378, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLRSTGQPSEQVCLRPGVSG
Protein accession: AAH47378
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009625-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009625-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged AATK is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AATK monoclonal antibody (M02), clone 2D10 now

Add to cart