Brand: | Abnova |
Reference: | H00009618-M01 |
Product name: | TRAF4 monoclonal antibody (M01), clone 3F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRAF4. |
Clone: | 3F6 |
Isotype: | IgG2a Kappa |
Gene id: | 9618 |
Gene name: | TRAF4 |
Gene alias: | CART1|MLN62|RNF83 |
Gene description: | TNF receptor-associated factor 4 |
Genbank accession: | BC001769 |
Immunogen: | TRAF4 (AAH01769, 371 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAVELPRKILS |
Protein accession: | AAH01769 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to TRAF4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |