Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MTRF1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about MTRF1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00009617-B01P |
| Product name: | MTRF1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human MTRF1 protein. |
| Gene id: | 9617 |
| Gene name: | MTRF1 |
| Gene alias: | MGC47721|MRF1|MTTRF1|RF1 |
| Gene description: | mitochondrial translational release factor 1 |
| Genbank accession: | ENST00000239852 |
| Immunogen: | MTRF1 (ENSP00000239852, 1 a.a. ~ 151 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNEENRRSLNRRHAELAPLAAIYQEIQETEQAIEELESMCKKTESCSVAQAGMQ |
| Protein accession: | ENSP00000239852 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MTRF1 expression in transfected 293T cell line by MTRF1 MaxPab polyclonal antibody. Lane 1: MTRF1 transfected lysate(16.61 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK. PLoS Comput Biol. 2011 Jun;7(6):e1002093. Epub 2011 Jun 30. |