RAB36 monoclonal antibody (M01), clone 6A6 View larger

RAB36 monoclonal antibody (M01), clone 6A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB36 monoclonal antibody (M01), clone 6A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about RAB36 monoclonal antibody (M01), clone 6A6

Brand: Abnova
Reference: H00009609-M01
Product name: RAB36 monoclonal antibody (M01), clone 6A6
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB36.
Clone: 6A6
Isotype: IgG2a Kappa
Gene id: 9609
Gene name: RAB36
Gene alias: -
Gene description: RAB36, member RAS oncogene family
Genbank accession: NM_004914
Immunogen: RAB36 (NP_004905, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC
Protein accession: NP_004905
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009609-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009609-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to RAB36 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB36 monoclonal antibody (M01), clone 6A6 now

Add to cart