No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00009604-D01P |
Product name: | RNF14 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human RNF14 protein. |
Gene id: | 9604 |
Gene name: | RNF14 |
Gene alias: | ARA54|FLJ26004|HFB30|HRIHFB2038|TRIAD2 |
Gene description: | ring finger protein 14 |
Genbank accession: | NM_183398.1 |
Immunogen: | RNF14 (NP_899645.1, 1 a.a. ~ 348 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED |
Protein accession: | NP_899645.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RNF14 expression in transfected 293T cell line (H00009604-T02) by RNF14 MaxPab polyclonal antibody. Lane 1: RNF14 transfected lysate(39.60 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |