Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAD2L1BP monoclonal antibody (M13), clone 4B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,IP |
More info about MAD2L1BP monoclonal antibody (M13), clone 4B9
| Brand: | Abnova |
| Reference: | H00009587-M13 |
| Product name: | MAD2L1BP monoclonal antibody (M13), clone 4B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAD2L1BP. |
| Clone: | 4B9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9587 |
| Gene name: | MAD2L1BP |
| Gene alias: | CMT2|KIAA0110|MGC11282|RP1-261G23.6 |
| Gene description: | MAD2L1 binding protein |
| Genbank accession: | NM_014628 |
| Immunogen: | MAD2L1BP (NP_055443.1, 171 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE |
| Protein accession: | NP_055443.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of MAD2L1BP transfected lysate using anti-MAD2L1BP monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MAD2L1BP MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,IP |
| Shipping condition: | Dry Ice |