Brand: | Abnova |
Reference: | H00009586-M01 |
Product name: | CREB5 monoclonal antibody (M01), clone 1E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CREB5. |
Clone: | 1E2 |
Isotype: | IgG2a Kappa |
Gene id: | 9586 |
Gene name: | CREB5 |
Gene alias: | CRE-BPA |
Gene description: | cAMP responsive element binding protein 5 |
Genbank accession: | NM_001011666 |
Immunogen: | CREB5 (NP_001011666, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKA |
Protein accession: | NP_001011666 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CREB5 is approximately 3ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |