Brand: | Abnova |
Reference: | H00009585-A01 |
Product name: | MPHOSPH1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MPHOSPH1. |
Gene id: | 9585 |
Gene name: | KIF20B |
Gene alias: | DKFZp434B0435|DKFZp434P0810|KRMP1|MPHOSPH1|MPP-1|MPP1 |
Gene description: | kinesin family member 20B |
Genbank accession: | NM_016195 |
Immunogen: | MPHOSPH1 (NP_057279, 1671 a.a. ~ 1780 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RSQASIIGVNLATKKKEGTLQKFGDFLQHSPSILQSKAKKIIETMSSSKLSNVEASKENVSQPKRAKRKLYTSEISSPIDISGQVILMDQKMKESDHQIIKRRLRTKTAK |
Protein accession: | NP_057279 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00009585-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00009585-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |