Brand: | Abnova |
Reference: | H00009580-M01 |
Product name: | SOX13 monoclonal antibody (M01), clone 3E8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX13. |
Clone: | 3E8 |
Isotype: | IgG1 Kappa |
Gene id: | 9580 |
Gene name: | SOX13 |
Gene alias: | ICA12|MGC117216|Sox-13 |
Gene description: | SRY (sex determining region Y)-box 13 |
Genbank accession: | NM_005686 |
Immunogen: | SOX13 (NP_005677, 25 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KSEEKKEPCHEAPQGSATAAEPQPGDPARASQDSADPQAPAQGNFRGSWDCSSPEGNGSPEPKRPGVSEAASGSQEKLDFNRNLKEVVPAIEKLLSSDWKERFLGRNSMEAKDV |
Protein accession: | NP_005677 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SOX13 monoclonal antibody (M01), clone 3E8 Western Blot analysis of SOX13 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |