CDC42BPB monoclonal antibody (M01), clone 5F12 View larger

CDC42BPB monoclonal antibody (M01), clone 5F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC42BPB monoclonal antibody (M01), clone 5F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CDC42BPB monoclonal antibody (M01), clone 5F12

Brand: Abnova
Reference: H00009578-M01
Product name: CDC42BPB monoclonal antibody (M01), clone 5F12
Product description: Mouse monoclonal antibody raised against a partial recombinant CDC42BPB.
Clone: 5F12
Isotype: IgG2a Kappa
Gene id: 9578
Gene name: CDC42BPB
Gene alias: KIAA1124|MRCKB
Gene description: CDC42 binding protein kinase beta (DMPK-like)
Genbank accession: AF128625
Immunogen: CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP
Protein accession: AAD37506
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009578-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged CDC42BPB is approximately 1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CDC42BPB monoclonal antibody (M01), clone 5F12 now

Add to cart