Brand: | Abnova |
Reference: | H00009578-A01 |
Product name: | CDC42BPB polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CDC42BPB. |
Gene id: | 9578 |
Gene name: | CDC42BPB |
Gene alias: | KIAA1124|MRCKB |
Gene description: | CDC42 binding protein kinase beta (DMPK-like) |
Genbank accession: | AF128625 |
Immunogen: | CDC42BPB (AAD37506, 1580 a.a. ~ 1679 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTP |
Protein accession: | AAD37506 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.Adachi A, Kano F, Saido TC, Murata M. Genes Cells. 2009 Mar;14(3):355-69. Epub 2009 Feb 13. |