Brand: | Abnova |
Reference: | H00009573-M01 |
Product name: | GDF3 monoclonal antibody (M01), clone 2B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GDF3. |
Clone: | 2B10 |
Isotype: | IgG2b Kappa |
Gene id: | 9573 |
Gene name: | GDF3 |
Gene alias: | - |
Gene description: | growth differentiation factor 3 |
Genbank accession: | NM_020634 |
Immunogen: | GDF3 (NP_065685, 265 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG |
Protein accession: | NP_065685 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged GDF3 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |