GDF3 monoclonal antibody (M01), clone 2B10 View larger

GDF3 monoclonal antibody (M01), clone 2B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF3 monoclonal antibody (M01), clone 2B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about GDF3 monoclonal antibody (M01), clone 2B10

Brand: Abnova
Reference: H00009573-M01
Product name: GDF3 monoclonal antibody (M01), clone 2B10
Product description: Mouse monoclonal antibody raised against a partial recombinant GDF3.
Clone: 2B10
Isotype: IgG2b Kappa
Gene id: 9573
Gene name: GDF3
Gene alias: -
Gene description: growth differentiation factor 3
Genbank accession: NM_020634
Immunogen: GDF3 (NP_065685, 265 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG
Protein accession: NP_065685
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009573-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged GDF3 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy GDF3 monoclonal antibody (M01), clone 2B10 now

Add to cart