NR1D1 monoclonal antibody (M18), clone 4C2 View larger

NR1D1 monoclonal antibody (M18), clone 4C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NR1D1 monoclonal antibody (M18), clone 4C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NR1D1 monoclonal antibody (M18), clone 4C2

Brand: Abnova
Reference: H00009572-M18
Product name: NR1D1 monoclonal antibody (M18), clone 4C2
Product description: Mouse monoclonal antibody raised against a full-length recombinant NR1D1.
Clone: 4C2
Isotype: IgG2a Kappa
Gene id: 9572
Gene name: NR1D1
Gene alias: EAR1|THRA1|THRAL|ear-1|hRev
Gene description: nuclear receptor subfamily 1, group D, member 1
Genbank accession: NM_021724
Immunogen: NR1D1 (NP_068370, 233 a.a. ~ 322 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASG
Protein accession: NP_068370
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009572-M18-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged NR1D1 is approximately 30ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NR1D1 monoclonal antibody (M18), clone 4C2 now

Add to cart