GTF2IRD1 monoclonal antibody (M01), clone 1D2 View larger

GTF2IRD1 monoclonal antibody (M01), clone 1D2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTF2IRD1 monoclonal antibody (M01), clone 1D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about GTF2IRD1 monoclonal antibody (M01), clone 1D2

Brand: Abnova
Reference: H00009569-M01
Product name: GTF2IRD1 monoclonal antibody (M01), clone 1D2
Product description: Mouse monoclonal antibody raised against a partial recombinant GTF2IRD1.
Clone: 1D2
Isotype: IgG2b Kappa
Gene id: 9569
Gene name: GTF2IRD1
Gene alias: BEN|CREAM1|GTF3|MUSTRD1|RBAP2|WBS|WBSCR11|WBSCR12|hMusTRD1alpha1
Gene description: GTF2I repeat domain containing 1
Genbank accession: NM_005685
Immunogen: GTF2IRD1 (NP_005676, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSED
Protein accession: NP_005676
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009569-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009569-M01-1-6-1.jpg
Application image note: GTF2IRD1 monoclonal antibody (M01), clone 1D2 Western Blot analysis of GTF2IRD1 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GTF2IRD1 monoclonal antibody (M01), clone 1D2 now

Add to cart