Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GTPBP1 monoclonal antibody (M01), clone 1H1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about GTPBP1 monoclonal antibody (M01), clone 1H1
| Brand: | Abnova |
| Reference: | H00009567-M01 |
| Product name: | GTPBP1 monoclonal antibody (M01), clone 1H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GTPBP1. |
| Clone: | 1H1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 9567 |
| Gene name: | GTPBP1 |
| Gene alias: | GP-1|GP1|HSPC018|MGC20069 |
| Gene description: | GTP binding protein 1 |
| Genbank accession: | NM_004286 |
| Immunogen: | GTPBP1 (NP_004277, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEV |
| Protein accession: | NP_004277 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GTPBP1 expression in transfected 293T cell line by GTPBP1 monoclonal antibody (M01), clone 1H1. Lane 1: GTPBP1 transfected lysate(63.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |