Cart 66 Product Products 19 839,06 € (empty)
No products
To be determined Shipping
19 839,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 66 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 19 839,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 19 839,06 €
Data sheet of GTPBP1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about GTPBP1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00009567-D01P |
| Product name: | GTPBP1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human GTPBP1 protein. |
| Gene id: | 9567 |
| Gene name: | GTPBP1 |
| Gene alias: | GP-1|GP1|HSPC018|MGC20069 |
| Gene description: | GTP binding protein 1 |
| Genbank accession: | ENST00000335466 |
| Immunogen: | GTPBP1 (ENSP00000334787, 1 a.a. ~ 584 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDEGCGETIYVIGQGSDGTEYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKICEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLTKRDEGGPSGGPAVGAPPPGDEASSVGAGQPAASSNLQPQPKPSSGGRRRGGQRHKVKSQGACVTPASGC |
| Protein accession: | ENSP00000334787 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GTPBP1 expression in transfected 293T cell line (H00009567-T01) by GTPBP1 MaxPab polyclonal antibody. Lane 1: GTPBP1 transfected lysate(63.40 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |