H6PD polyclonal antibody (A01) View larger

H6PD polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of H6PD polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about H6PD polyclonal antibody (A01)

Brand: Abnova
Reference: H00009563-A01
Product name: H6PD polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant H6PD.
Gene id: 9563
Gene name: H6PD
Gene alias: DKFZp686A01246|G6PDH|GDH|MGC87643
Gene description: hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)
Genbank accession: NM_004285
Immunogen: H6PD (NP_004276, 401 a.a. ~ 500 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HIGHGDLGSPAVLVSRNLFRPSLPSSWKEMEGPPGLRLFGSPLSDYYAYSPVRERDAHSVLLSHIFHGRKNFFITTENLLASWNFWTPLLESLAHKAPRL
Protein accession: NP_004276
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009563-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy H6PD polyclonal antibody (A01) now

Add to cart