Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SEC22L1 monoclonal antibody (M01), clone 1E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about SEC22L1 monoclonal antibody (M01), clone 1E1
| Brand: | Abnova |
| Reference: | H00009554-M01 |
| Product name: | SEC22L1 monoclonal antibody (M01), clone 1E1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SEC22L1. |
| Clone: | 1E1 |
| Isotype: | IgG2a Lambda |
| Gene id: | 9554 |
| Gene name: | SEC22B |
| Gene alias: | ERS-24|SEC22L1 |
| Gene description: | SEC22 vesicle trafficking protein homolog B (S. cerevisiae) |
| Genbank accession: | NM_004892 |
| Immunogen: | SEC22L1 (NP_004883, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPY |
| Protein accession: | NP_004883 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to SEC22L1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Quantitative and temporal proteome analysis of butyrate-treated colorectal cancer cells.Tan HT, Tan S, Lin Q, Lim TK, Hew CL, Chung MC. Mol Cell Proteomics. 2008 Jun;7(6):1174-85. Epub 2008 Mar 14. |