IGDCC3 monoclonal antibody (M01), clone 6B12 View larger

IGDCC3 monoclonal antibody (M01), clone 6B12

H00009543-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IGDCC3 monoclonal antibody (M01), clone 6B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IGDCC3 monoclonal antibody (M01), clone 6B12

Brand: Abnova
Reference: H00009543-M01
Product name: IGDCC3 monoclonal antibody (M01), clone 6B12
Product description: Mouse monoclonal antibody raised against a partial recombinant IGDCC3.
Clone: 6B12
Isotype: IgG1 Kappa
Gene id: 9543
Gene name: IGDCC3
Gene alias: HsT18880|PUNC
Gene description: immunoglobulin superfamily, DCC subclass, member 3
Genbank accession: NM_004884
Immunogen: IGDCC3 (NP_004875.1, 37 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GHSAELAFAVEPSDDVAVPGQPIVLDCRVEGTPPVRITWRKNGVELPESTHSTLLANGSLMIRHFRLEPGGSPSDEGDYECVAQNRFGLVVSRKARIQAA
Protein accession: NP_004875.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00009543-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009543-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged IGDCC3 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IGDCC3 monoclonal antibody (M01), clone 6B12 now

Add to cart