Cart 56 Product Products 18 759,03 € (empty)
No products
To be determined Shipping
18 759,03 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 56 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 759,03 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 759,03 €
Data sheet of TP53I3 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about TP53I3 purified MaxPab rabbit polyclonal antibody (D02P)
| Brand: | Abnova |
| Reference: | H00009540-D02P |
| Product name: | TP53I3 purified MaxPab rabbit polyclonal antibody (D02P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TP53I3 protein. |
| Gene id: | 9540 |
| Gene name: | TP53I3 |
| Gene alias: | PIG3 |
| Gene description: | tumor protein p53 inducible protein 3 |
| Genbank accession: | BC000474.1 |
| Immunogen: | TP53I3 (AAH00474.1, 1 a.a. ~ 332 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ |
| Protein accession: | AAH00474.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TP53I3 expression in transfected 293T cell line (H00009540-T04) by TP53I3 MaxPab polyclonal antibody. Lane 1: TP53I3 transfected lysate(36.63 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |