TP53I3 purified MaxPab mouse polyclonal antibody (B02P) View larger

TP53I3 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TP53I3 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TP53I3 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00009540-B02P
Product name: TP53I3 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human TP53I3 protein.
Gene id: 9540
Gene name: TP53I3
Gene alias: PIG3
Gene description: tumor protein p53 inducible protein 3
Genbank accession: NM_004881
Immunogen: TP53I3 (NP_004872, 1 a.a. ~ 332 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Protein accession: NP_004872
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009540-B02P-13-15-1.jpg
Application image note: Western Blot analysis of TP53I3 expression in transfected 293T cell line (H00009540-T01) by TP53I3 MaxPab polyclonal antibody.

Lane 1: TP53I3 transfected lysate(36.52 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TP53I3 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart