PTGES (Human) Recombinant Protein (Q01) View larger

PTGES (Human) Recombinant Protein (Q01)

New product

199,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTGES (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PTGES (Human) Recombinant Protein (Q01)

Reference: H00009536-Q01
Product name: PTGES (Human) Recombinant Protein (Q01)
Product description: Human PTGES partial ORF ( NP_004869, 100 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 9536
Gene name: PTGES
Gene alias: MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1
Gene description: prostaglandin E synthase
Genbank accession: NM_004878
Immunogen sequence/protein sequence: WMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Protein accession: NP_004869
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

Reviews

Buy PTGES (Human) Recombinant Protein (Q01) now

Add to cart