PTGES MaxPab rabbit polyclonal antibody (D01) View larger

PTGES MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTGES MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr,IP

More info about PTGES MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00009536-D01
Product name: PTGES MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human PTGES protein.
Gene id: 9536
Gene name: PTGES
Gene alias: MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1
Gene description: prostaglandin E synthase
Genbank accession: NM_004878.3
Immunogen: PTGES (NP_004869.1, 1 a.a. ~ 152 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Protein accession: NP_004869.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00009536-D01-2-C4-1.jpg
Application image note: PTGES MaxPab rabbit polyclonal antibody. Western Blot analysis of PTGES expression in mouse spleen.
Applications: WB-Ce,WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy PTGES MaxPab rabbit polyclonal antibody (D01) now

Add to cart