PTGES purified MaxPab mouse polyclonal antibody (B01P) View larger

PTGES purified MaxPab mouse polyclonal antibody (B01P)

H00009536-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTGES purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about PTGES purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00009536-B01P
Product name: PTGES purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PTGES protein.
Gene id: 9536
Gene name: PTGES
Gene alias: MGC10317|MGST-IV|MGST1-L1|MGST1L1|MPGES|PGES|PIG12|PP102|PP1294|TP53I12|mPGES-1
Gene description: prostaglandin E synthase
Genbank accession: NM_004878.3
Immunogen: PTGES (NP_004869.1, 1 a.a. ~ 152 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Protein accession: NP_004869.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009536-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PTGES expression in transfected 293T cell line (H00009536-T01) by PTGES MaxPab polyclonal antibody.

Lane 1: PTGES transfected lysate(16.72 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PTGES purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart