NAPSA purified MaxPab mouse polyclonal antibody (B02P) View larger

NAPSA purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAPSA purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NAPSA purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00009476-B02P
Product name: NAPSA purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human NAPSA protein.
Gene id: 9476
Gene name: NAPSA
Gene alias: KAP|Kdap|NAP1|NAPA|SNAPA
Gene description: napsin A aspartic peptidase
Genbank accession: NM_004851.1
Immunogen: NAPSA (NP_004842.1, 1 a.a. ~ 420 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSPPPLLQPLLLLLPLLNVEPSGATLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Protein accession: NP_004842.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00009476-B02P-13-15-1.jpg
Application image note: Western Blot analysis of NAPSA expression in transfected 293T cell line (H00009476-T02) by NAPSA MaxPab polyclonal antibody.

Lane 1: NAPSA transfected lysate(46.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NAPSA purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart