C1orf38 purified MaxPab rabbit polyclonal antibody (D01P) View larger

C1orf38 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1orf38 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IF,WB-Tr

More info about C1orf38 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00009473-D01P
Product name: C1orf38 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human C1orf38 protein.
Gene id: 9473
Gene name: C1orf38
Gene alias: ICB-1
Gene description: chromosome 1 open reading frame 38
Genbank accession: BC081568.1
Immunogen: C1orf38 (AAH81568.1, 1 a.a. ~ 132 a.a) full-length human protein.
Immunogen sequence/protein sequence: MHLGIRSARCVLGMEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHSELPGQMDARCWGRERGLPLGAALMEDTPTPSLRISWNFRLLPLYYTEVILFF
Protein accession: AAH81568.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00009473-D01P-13-15-1.jpg
Application image note: Western Blot analysis of C1orf38 expression in transfected 293T cell line (H00009473-T02) by C1orf38 MaxPab polyclonal antibody.

Lane 1: C1orf38 transfected lysate(15.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1orf38 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart